PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna20888.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 399aa    MW: 43822.4 Da    PI: 7.2127
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna20888.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-183479147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                             rg+W++ Edell ++v+q+G ++W+ Iar ++ gR++k+c++rw + 
  mrna20888.1-v1.0-hybrid 34 RGSWSPKEDELLTRLVTQFGARNWSVIARGIP-GRSGKSCRLRWCNQ 79
                             89******************************.***********985 PP

2Myb_DNA-binding54.33.1e-1786130147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              r++++ eEd ++v a++ +G++ W+ Ia+ ++ gRt++ +k++w++ 
  mrna20888.1-v1.0-hybrid  86 RKPFSDEEDRIIVAAHATHGNR-WSIIAKLLP-GRTDNAIKNHWNST 130
                              789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9482980IPR017930Myb domain
SuperFamilySSF466891.29E-2931127IPR009057Homeodomain-like
SMARTSM007174.5E-153382IPR001005SANT/Myb domain
PfamPF002491.9E-163479IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-253587IPR009057Homeodomain-like
CDDcd001673.42E-143678No hitNo description
PROSITE profilePS5129426.7281135IPR017930Myb domain
SMARTSM007173.1E-1785133IPR001005SANT/Myb domain
PfamPF002499.3E-1586130IPR001005SANT/Myb domain
CDDcd001677.95E-1388131No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2488133IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MTLPNDAAPP NPAEPGASPP HADEGGEIAA GKVRGSWSPK EDELLTRLVT QFGARNWSVI  60
ARGIPGRSGK SCRLRWCNQL NPGVKRKPFS DEEDRIIVAA HATHGNRWSI IAKLLPGRTD  120
NAIKNHWNST LKRGRKYIPR TRNMKEDSGV ERSKTSSEET VSVGNISSVR IPEGREVFIV  180
DNSSNQNQDG VGVTELKDNP TLVAELKEDS TLCRPVARVS AFSAYNSSNG SVVPRPVPIP  240
GPLVQTSKLN LDFCNSLEGD CNEPMVPLHC GHGCCDRRHV HSESSLLGPE FIDYEEPPSF  300
SSPEFISCAT DMNNVAWIKS GLENRETIRV AENVASQRFS QGTLATPQMG YYEMNMMNGH  360
MRFVDGQNRL MTGMMTEMLS TQMPRQTFAM PTEVKGLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C5e-38331333103C-Myb DNA-Binding Domain
1mse_C5e-38331333103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004307600.10.0PREDICTED: transcription factor MYB86-like
TrEMBLA0FK201e-159A0FK20_MALDO; MYB domain class transcription factor
STRINGVIT_08s0007g01540.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39863362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.15e-86myb domain protein 109